(data stored in ACNUC1104 zone)

EMBL: CP000509.PE524

CP000509.PE524       Location/Qualifiers
FT   CDS             563712..565241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0532"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: rha:RHA1_ro05921 probable NADH dehydrogenase
FT                   subunit M; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80074"
FT                   /db_xref="GOA:A1SE39"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE39"
FT                   /protein_id="ABL80074.1"
FT                   /translation="MNDLPWLTALWVLPLVGALVTAFVPRATGSALPKQVGLLFALLTL
FT                   AVGIAIAVQYDTGDGMQLTETHTWIEAFGVNYALGVDGLGLLLILMTVALVPLVLVATW
FT                   NDADDRSSAAFVAWALALESFSLAVFAATDVFLFYMVFEATLIPAYFLIGRFGQAGRGR
FT                   AALKFLMYQLGGGLVLLASVIGLYVVSADAGNPSYLLSDLQQLDLSTNTERWLFVGFMI
FT                   AFAVKAPLFPLHTWLADTTEKATPGTSVLLVCILDKIGTFGMLRFGLGLFPEASQWATP
FT                   VVVALALVSIVYGALVAIGQDDILRLIGLTSLSHFGFITLGIFAFSSQGGSGAILYMVN
FT                   HGVGTAALFLIAGYLIRRKGTQLISQIAGVETKAPLLAGLFLVAGLSTLGLPGLSQFVS
FT                   EILVLISAFDYHWWVGAIAVTGIVLAAIYVLWLYQRTMTGPATPGDEAMTDLNRRELVA
FT                   VVPLIAALVFFGFFPMPLLDVSNPTVDSLLQHVGVSDEAPTVADHAEEGAH"
     MNDLPWLTAL WVLPLVGALV TAFVPRATGS ALPKQVGLLF ALLTLAVGIA IAVQYDTGDG        60
     MQLTETHTWI EAFGVNYALG VDGLGLLLIL MTVALVPLVL VATWNDADDR SSAAFVAWAL       120
     ALESFSLAVF AATDVFLFYM VFEATLIPAY FLIGRFGQAG RGRAALKFLM YQLGGGLVLL       180
     ASVIGLYVVS ADAGNPSYLL SDLQQLDLST NTERWLFVGF MIAFAVKAPL FPLHTWLADT       240
     TEKATPGTSV LLVCILDKIG TFGMLRFGLG LFPEASQWAT PVVVALALVS IVYGALVAIG       300
     QDDILRLIGL TSLSHFGFIT LGIFAFSSQG GSGAILYMVN HGVGTAALFL IAGYLIRRKG       360
     TQLISQIAGV ETKAPLLAGL FLVAGLSTLG LPGLSQFVSE ILVLISAFDY HWWVGAIAVT       420
     GIVLAAIYVL WLYQRTMTGP ATPGDEAMTD LNRRELVAVV PLIAALVFFG FFPMPLLDVS       480
     NPTVDSLLQH VGVSDEAPTV ADHAEEGAH                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page