(data stored in ACNUC1104 zone)

EMBL: CP000509.PE525

CP000509.PE525       Location/Qualifiers
FT   CDS             565241..566842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0533"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: rha:RHA1_ro05922 probable NADH dehydrogenase
FT                   subunit N; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80075"
FT                   /db_xref="GOA:A1SE40"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE40"
FT                   /protein_id="ABL80075.1"
FT                   /translation="MDFIKPTIEYGDVWPLLVVFGVAAVGVLVEGFVPRAQRYLVQAAL
FT                   AIAGVVVALVGTILVARDLDVLGDGAARGAIDVEGTIAVDGPALFIWGMLLVFALGGAL
FT                   LFAERRLEGGVSAFAGQAAALPGTEAERQASTRGLEHTEVYPLMMFALGGMMLFAAAND
FT                   LLTLFVALEVLSLPLYLLSGLARRRRLLSQEAALKYFMLGAFSSGFFLYGAALVYGFSG
FT                   SMGFAEINEAVRDDVGNQTLLLIGIGMLSVGLLFKVGAVPFHSWTPDVYQGAPTAVTAF
FT                   MAAGTKIAAFGAMLRLFYVAFGSDRWSWQPMLWIIAILTMLVGALIAIVQTDMKRMLAY
FT                   SSVAHTGFLLTGVLGVQQASELADGEVTSLQAVLFYLVTYGFAVVGAFAVVTLVRDAGG
FT                   EAGQFVRWRGIGRRSPLVAGVFAFFLLSMAGIPLTAGFVGKWAVFTVALAAGAWPVVIA
FT                   AVLCSIIAVFFYVRVILLMFFEDDDVSAQGEVASVTKPSVLTSATIFVGVAATLVLGVV
FT                   PGPVLDLAANAGQFVR"
     MDFIKPTIEY GDVWPLLVVF GVAAVGVLVE GFVPRAQRYL VQAALAIAGV VVALVGTILV        60
     ARDLDVLGDG AARGAIDVEG TIAVDGPALF IWGMLLVFAL GGALLFAERR LEGGVSAFAG       120
     QAAALPGTEA ERQASTRGLE HTEVYPLMMF ALGGMMLFAA ANDLLTLFVA LEVLSLPLYL       180
     LSGLARRRRL LSQEAALKYF MLGAFSSGFF LYGAALVYGF SGSMGFAEIN EAVRDDVGNQ       240
     TLLLIGIGML SVGLLFKVGA VPFHSWTPDV YQGAPTAVTA FMAAGTKIAA FGAMLRLFYV       300
     AFGSDRWSWQ PMLWIIAILT MLVGALIAIV QTDMKRMLAY SSVAHTGFLL TGVLGVQQAS       360
     ELADGEVTSL QAVLFYLVTY GFAVVGAFAV VTLVRDAGGE AGQFVRWRGI GRRSPLVAGV       420
     FAFFLLSMAG IPLTAGFVGK WAVFTVALAA GAWPVVIAAV LCSIIAVFFY VRVILLMFFE       480
     DDDVSAQGEV ASVTKPSVLT SATIFVGVAA TLVLGVVPGP VLDLAANAGQ FVR              533
//

If you have problems or comments...

PBIL Back to PBIL home page