(data stored in ACNUC1104 zone)

EMBL: CP000509.PE528

CP000509.PE528       Location/Qualifiers
FT   CDS             complement(569507..570622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0536"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: sma:SAV4876 2-oxoglutarate ferredoxin
FT                   oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80078"
FT                   /db_xref="GOA:A1SE43"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE43"
FT                   /protein_id="ABL80078.1"
FT                   /translation="MTTDLNFPGLRSGVELVPTTDQSQTGKDYTSDQEVRWCPGCGDYA
FT                   VLKAVQGFLPDLGLRRENIVFISGIGCSSRFPYYLDTYGMHSIHGRAPSIATGIATARE
FT                   DLSVWVVTGDGDALSIGGNHLIHALRRNVNMTILLFNNRIYGLTKGQYSPTSEAGKITK
FT                   STPMGSLDHPFNPVSLALGAEGSFVARTIDSDRKHLTSVLSAAAAHRGTSFVEIYQNCP
FT                   IFNDGAFDALKSPDTKADAIIPLVHGEPIRFGAPDSNGLGTKGLIRDVGPGGTGGVKIV
FT                   DLADLGDAAEDKVLVHDAYNPDPSTAFAISRLTDSGYLHQSPIGIFRQVERPTYDDQAR
FT                   AQVSEAKAAHPGDRSERLAALIGGGDTWTVV"
     MTTDLNFPGL RSGVELVPTT DQSQTGKDYT SDQEVRWCPG CGDYAVLKAV QGFLPDLGLR        60
     RENIVFISGI GCSSRFPYYL DTYGMHSIHG RAPSIATGIA TAREDLSVWV VTGDGDALSI       120
     GGNHLIHALR RNVNMTILLF NNRIYGLTKG QYSPTSEAGK ITKSTPMGSL DHPFNPVSLA       180
     LGAEGSFVAR TIDSDRKHLT SVLSAAAAHR GTSFVEIYQN CPIFNDGAFD ALKSPDTKAD       240
     AIIPLVHGEP IRFGAPDSNG LGTKGLIRDV GPGGTGGVKI VDLADLGDAA EDKVLVHDAY       300
     NPDPSTAFAI SRLTDSGYLH QSPIGIFRQV ERPTYDDQAR AQVSEAKAAH PGDRSERLAA       360
     LIGGGDTWTV V                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page