(data stored in ACNUC1104 zone)

EMBL: CP000509.PE529

CP000509.PE529       Location/Qualifiers
FT   CDS             complement(570619..572601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0537"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: tfu:Tfu_2674 2-oxoglutarate
FT                   ferredoxin oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80079"
FT                   /db_xref="GOA:A1SE44"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE44"
FT                   /protein_id="ABL80079.1"
FT                   /translation="MSVQQGKQVKQLDRVIIRFAGDSGDGMQLTGDRFTQESAVFGNDL
FT                   VTLPNFPAEIRAPQGTLPGVSSFQVHFADHDILTAGDAPDVLVAMNPAALKANLGDLPK
FT                   GAAIIVDTHDFTSRNLAKAGYATNPLDVLGDVNDPLGAFAVHAVDLTGMTIEAVKEFGL
FT                   SRKDAARAKNMFALGLLSWMYGRPTEPTITFLEKRFAKVADIRDANIAAFKAGWNFGET
FT                   TETFVVQYEIKPAPMAPGTYRNITGNLALAYGLVAGGVQSGLPVFLGSYPITPASDILH
FT                   ELSKHKAFGVTTFQAEDEIAGVGSAIGASFAGSLAVTTTSGPGIALKSEAIGLAVMTEL
FT                   PLVVVDVQRGGPSTGLPTKTEQADLLQAMFGRNGEAPVPIVAPRSPGDCFDAALEACRI
FT                   AVTYRTPVMLLSDGYLANGSEPWRIPELADLPTIDPAFASPAAEGDTFQPYSRDPETLA
FT                   RPWAPPGTAGLEHRIGGLEKADITGNISYDPANHDFMVRTRQAKVDRIAESLPPLEVDD
FT                   PSAEDGQGAKVVVLGWGSTYGPIGAGVRRVRKAGYRVAQVHLRHLNPFPKDLGEILARY
FT                   DKVLVPEMNLGQLSLLIRAKYLVDAVGYNQVRGLPLKAAEVAQAIGELISQAEGIQVDL
FT                   TDTTTADTTAGSTASTAVSTEEALS"
     MSVQQGKQVK QLDRVIIRFA GDSGDGMQLT GDRFTQESAV FGNDLVTLPN FPAEIRAPQG        60
     TLPGVSSFQV HFADHDILTA GDAPDVLVAM NPAALKANLG DLPKGAAIIV DTHDFTSRNL       120
     AKAGYATNPL DVLGDVNDPL GAFAVHAVDL TGMTIEAVKE FGLSRKDAAR AKNMFALGLL       180
     SWMYGRPTEP TITFLEKRFA KVADIRDANI AAFKAGWNFG ETTETFVVQY EIKPAPMAPG       240
     TYRNITGNLA LAYGLVAGGV QSGLPVFLGS YPITPASDIL HELSKHKAFG VTTFQAEDEI       300
     AGVGSAIGAS FAGSLAVTTT SGPGIALKSE AIGLAVMTEL PLVVVDVQRG GPSTGLPTKT       360
     EQADLLQAMF GRNGEAPVPI VAPRSPGDCF DAALEACRIA VTYRTPVMLL SDGYLANGSE       420
     PWRIPELADL PTIDPAFASP AAEGDTFQPY SRDPETLARP WAPPGTAGLE HRIGGLEKAD       480
     ITGNISYDPA NHDFMVRTRQ AKVDRIAESL PPLEVDDPSA EDGQGAKVVV LGWGSTYGPI       540
     GAGVRRVRKA GYRVAQVHLR HLNPFPKDLG EILARYDKVL VPEMNLGQLS LLIRAKYLVD       600
     AVGYNQVRGL PLKAAEVAQA IGELISQAEG IQVDLTDTTT ADTTAGSTAS TAVSTEEALS       660
//

If you have problems or comments...

PBIL Back to PBIL home page