(data stored in ACNUC1104 zone)

EMBL: CP000509.PE530

CP000509.PE530       Location/Qualifiers
FT   CDS             572921..573958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0538"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein, family 1; KEGG: mmc:Mmcs_3482 thiosulphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80080"
FT                   /db_xref="GOA:A1SE45"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE45"
FT                   /protein_id="ABL80080.1"
FT                   /translation="MKTSIKVAAAAFAGVLALTGCSASADGDADETVNVNAFSVMEAAN
FT                   EPVFADFAATEEGKGVRFETSYGASGDQSRAVVAGAAADVVHYSLETDVTRLVDEGLVA
FT                   EDWKDDATNGIATSSVVVFVVRKGNPENIQTWDDLVKPGVEIITPNPGSSGSARWNILA
FT                   AWAHVTGNGGSAEDAKSFLTRLLDNTIALPGSGREATTAFTDGSGDVLLSYENEAILAK
FT                   QSGADVDYVLPPDTLLIENPAAVTVDADETAQAFLEFMTSPEAQADYAQSGFRPVVDGV
FT                   DIGAVEGANDPSDPFPAPDRLFTIDGDFGGWGEAADKYFGDGEEGHPLGIITELQQQTG
FT                   KVGEE"
     MKTSIKVAAA AFAGVLALTG CSASADGDAD ETVNVNAFSV MEAANEPVFA DFAATEEGKG        60
     VRFETSYGAS GDQSRAVVAG AAADVVHYSL ETDVTRLVDE GLVAEDWKDD ATNGIATSSV       120
     VVFVVRKGNP ENIQTWDDLV KPGVEIITPN PGSSGSARWN ILAAWAHVTG NGGSAEDAKS       180
     FLTRLLDNTI ALPGSGREAT TAFTDGSGDV LLSYENEAIL AKQSGADVDY VLPPDTLLIE       240
     NPAAVTVDAD ETAQAFLEFM TSPEAQADYA QSGFRPVVDG VDIGAVEGAN DPSDPFPAPD       300
     RLFTIDGDFG GWGEAADKYF GDGEEGHPLG IITELQQQTG KVGEE                       345
//

If you have problems or comments...

PBIL Back to PBIL home page