(data stored in ACNUC1104 zone)

EMBL: CP000509.PE531

CP000509.PE531       Location/Qualifiers
FT   CDS             573958..574839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0539"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysT; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mbo:Mb2421c probable
FT                   sulfate-transport integral membrane protein ABC transporter
FT                   CysT"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80081"
FT                   /db_xref="GOA:A1SE46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE46"
FT                   /protein_id="ABL80081.1"
FT                   /translation="MPTALLEGPRDSAEPASHGGRRRRRARRTARRNTLTPGAGLGLGI
FT                   SMIWFSLLVLIPLAAVVAAASAGGWDGYLRVLQNDQTWAAIKLTVTQSLAVTLVNVVMG
FT                   TVIAWVLVRDRFWGRSVLDVIIDVPFAMPTVVAGLLLLSLYGPSSPIGVHWANTERAVS
FT                   LALAFVTLPFVVRTVQPVLEELDADVEEAAASLGAGRATVVRRIVLPSLAPAIAAGAAL
FT                   SFARAISEYGSLVLLSGNRPFQTEVVSVRVLTFIENGSNTSAAAVASVMLAVALVVIVS
FT                   LDLVQRRVARRG"
     MPTALLEGPR DSAEPASHGG RRRRRARRTA RRNTLTPGAG LGLGISMIWF SLLVLIPLAA        60
     VVAAASAGGW DGYLRVLQND QTWAAIKLTV TQSLAVTLVN VVMGTVIAWV LVRDRFWGRS       120
     VLDVIIDVPF AMPTVVAGLL LLSLYGPSSP IGVHWANTER AVSLALAFVT LPFVVRTVQP       180
     VLEELDADVE EAAASLGAGR ATVVRRIVLP SLAPAIAAGA ALSFARAISE YGSLVLLSGN       240
     RPFQTEVVSV RVLTFIENGS NTSAAAVASV MLAVALVVIV SLDLVQRRVA RRG              293
//

If you have problems or comments...

PBIL Back to PBIL home page