(data stored in SCRATCH zone)

EMBL: CP000509.PE532

CP000509.PE532       Location/Qualifiers
FT   CDS             574832..575653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0540"
FT                   /product="sulfate ABC transporter, inner membrane subunit"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mtc:MT2469 sulfate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80082"
FT                   /db_xref="GOA:A1SE47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE47"
FT                   /protein_id="ABL80082.1"
FT                   /translation="MVEVSTPTRWLLRALATGYVFFLVAWPVGLLGRRTFDGGPGNLTD
FT                   MLADDRAVAALQLTAVVAFWAVVINLVFGVTVSILLVRYEFPGKRVLSALIDLPLSVSP
FT                   VVVGLALVLVYNGRDGWFGTTLEDNGLQVIFNSPGMIMATCFVALPLVIREVVPVLTEI
FT                   GDDQEQAARSLGAGARQTFLRITLPSIRWALVYGVVLALARSIGEFGAVKIVSGNITGR
FT                   TQTATLAVEAKYQNFQQPEAYAIAFLLALVCIACLVVVAVLRPRRAHRPRP"
     MVEVSTPTRW LLRALATGYV FFLVAWPVGL LGRRTFDGGP GNLTDMLADD RAVAALQLTA        60
     VVAFWAVVIN LVFGVTVSIL LVRYEFPGKR VLSALIDLPL SVSPVVVGLA LVLVYNGRDG       120
     WFGTTLEDNG LQVIFNSPGM IMATCFVALP LVIREVVPVL TEIGDDQEQA ARSLGAGARQ       180
     TFLRITLPSI RWALVYGVVL ALARSIGEFG AVKIVSGNIT GRTQTATLAV EAKYQNFQQP       240
     EAYAIAFLLA LVCIACLVVV AVLRPRRAHR PRP                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page