(data stored in ACNUC1104 zone)

EMBL: CP000509.PE540

CP000509.PE540       Location/Qualifiers
FT   CDS             581823..582059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80090"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE55"
FT                   /protein_id="ABL80090.1"
FT                   /translation="MTTTPKKQLTPFISVQGAPIRLFLTRQQAAVACGVSPATISRVKN
FT                   TGALKAKKTAPRGGRELYRIEDLQAWFDGLDDA"
     MTTTPKKQLT PFISVQGAPI RLFLTRQQAA VACGVSPATI SRVKNTGALK AKKTAPRGGR        60
     ELYRIEDLQA WFDGLDDA                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page