(data stored in ACNUC1104 zone)

EMBL: CP000509.PE542

CP000509.PE542       Location/Qualifiers
FT   CDS             complement(582461..585370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0550"
FT                   /product="phage tail tape measure protein, TP901 family"
FT                   /note="TIGRFAM: phage tail tape measure protein, TP901
FT                   family; KEGG: nfa:nfa15380 putative phage tail"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80092"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE57"
FT                   /protein_id="ABL80092.1"
FT                   /translation="MARADITRTSGTVSRLGRTASRTGRLLGAAFAVGSIARAAVAVGK
FT                   VGAGYVDSLNKIQALTGSTDASLSRIARRLESQASVYAKFGQTTGDAAAGMVELTKSGL
FT                   SARKALGAIRGTMILAKAGELEVADASELVANTLNTFSLKASKASKIANGLANAANISS
FT                   ANVTDLAESFKYAAPLAAKAGLPLDQVNAILAELSNSGIKASQAGTSLRGILLALQAPS
FT                   TAGATALEDLGVRVYDARGRMRDFGDLLEDLRKGLGRLSDEGRNSALKSIFGRNAITGA
FT                   QVLLKGGRQALDEYTAGVRRAGAAQALAESSSRGLAGTINQIKAAATSTAQALYRIYSP
FT                   VIDRALRTALEFATKHKKVLIPALAGAAAAAAGAAAALGAIALVTSPTALAVSAVVGLG
FT                   AAVSVAYKRSETFRNAVAATADALRSFGGYLQGTVLPAVTRTAREIAQRLQPVLAQAGQ
FT                   TFRSDIAPALAQVAAQFREWQPTIRRVAETAGRLTAQVLIFQAKLSGKVIPVLIRLGGI
FT                   MARTNIPVALRLADALVKLTAANMRTGAAMLAAGQKAARFAAAVRSKFNDAIAFMTTVP
FT                   GRIKGALGDLSNILYAAGRSVISGLISGIVDKAQDLWNTLAGITSKIPLHKGPPARDRK
FT                   LLRGTGRLIMAGLIRGIDDGSEGIKRALERITQLIQKRLDGKKQADRRKSLLKSLKDEG
FT                   AALRANGKLQDAVARALEKATSRYKDLIRTSREYAASVKAGFQSYGSVVGLGTTGGGTA
FT                   VTLPALLSQLAARASVADQFTAIIEKLKSRLNKTSLKQLLDQAAQGDLEGALATAQAIA
FT                   SGGPAAVAQINALTAQIGKAGGKLGDSAAASLFAAGIRAAEGFAKGLKRQERRLDQTAD
FT                   RMADRLVDRIRTQLGIGKTSAPRTPAPRFSASDTYAGRTPAYDAYMRQAARPSSGGDVH
FT                   ITLNVQAPVGSSSQDIGRTLTKHLDAYFGAGGRRHTRWA"
     MARADITRTS GTVSRLGRTA SRTGRLLGAA FAVGSIARAA VAVGKVGAGY VDSLNKIQAL        60
     TGSTDASLSR IARRLESQAS VYAKFGQTTG DAAAGMVELT KSGLSARKAL GAIRGTMILA       120
     KAGELEVADA SELVANTLNT FSLKASKASK IANGLANAAN ISSANVTDLA ESFKYAAPLA       180
     AKAGLPLDQV NAILAELSNS GIKASQAGTS LRGILLALQA PSTAGATALE DLGVRVYDAR       240
     GRMRDFGDLL EDLRKGLGRL SDEGRNSALK SIFGRNAITG AQVLLKGGRQ ALDEYTAGVR       300
     RAGAAQALAE SSSRGLAGTI NQIKAAATST AQALYRIYSP VIDRALRTAL EFATKHKKVL       360
     IPALAGAAAA AAGAAAALGA IALVTSPTAL AVSAVVGLGA AVSVAYKRSE TFRNAVAATA       420
     DALRSFGGYL QGTVLPAVTR TAREIAQRLQ PVLAQAGQTF RSDIAPALAQ VAAQFREWQP       480
     TIRRVAETAG RLTAQVLIFQ AKLSGKVIPV LIRLGGIMAR TNIPVALRLA DALVKLTAAN       540
     MRTGAAMLAA GQKAARFAAA VRSKFNDAIA FMTTVPGRIK GALGDLSNIL YAAGRSVISG       600
     LISGIVDKAQ DLWNTLAGIT SKIPLHKGPP ARDRKLLRGT GRLIMAGLIR GIDDGSEGIK       660
     RALERITQLI QKRLDGKKQA DRRKSLLKSL KDEGAALRAN GKLQDAVARA LEKATSRYKD       720
     LIRTSREYAA SVKAGFQSYG SVVGLGTTGG GTAVTLPALL SQLAARASVA DQFTAIIEKL       780
     KSRLNKTSLK QLLDQAAQGD LEGALATAQA IASGGPAAVA QINALTAQIG KAGGKLGDSA       840
     AASLFAAGIR AAEGFAKGLK RQERRLDQTA DRMADRLVDR IRTQLGIGKT SAPRTPAPRF       900
     SASDTYAGRT PAYDAYMRQA ARPSSGGDVH ITLNVQAPVG SSSQDIGRTL TKHLDAYFGA       960
     GGRRHTRWA                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page