(data stored in ACNUC1104 zone)

EMBL: CP000509.PE544

CP000509.PE544       Location/Qualifiers
FT   CDS             complement(585699..586034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80094"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE59"
FT                   /protein_id="ABL80094.1"
FT                   /translation="MSFEEDRARDRVREAANAGYLSNWAAARERFEQATREWEAAAREY
FT                   RDAYHRIADRNPLLDEFGLTTGEVAPLGARDQAVLDAAEHLEAQAWARRQAAATAFERA
FT                   DDFSHPW"
     MSFEEDRARD RVREAANAGY LSNWAAARER FEQATREWEA AAREYRDAYH RIADRNPLLD        60
     EFGLTTGEVA PLGARDQAVL DAAEHLEAQA WARRQAAATA FERADDFSHP W                111
//

If you have problems or comments...

PBIL Back to PBIL home page