(data stored in ACNUC1104 zone)

EMBL: CP000509.PE546

CP000509.PE546       Location/Qualifiers
FT   CDS             complement(586429..587172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80096"
FT                   /db_xref="GOA:A1SE61"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE61"
FT                   /protein_id="ABL80096.1"
FT                   /translation="MSTNPPPHQPCPAASPTDQVVDERALALAFHESGHAVAAVCLGNA
FT                   VEAVTIAGGRTHAGLTLWWSETTDEARALLKSGGRDADRDLFLRARGRLEQDVMITLAG
FT                   DVAEALGRLEARWLATTRRGELRKSHAGTVQRAPVLERHVEALAGRDEDRVHARERAAS
FT                   EADDHQEAGLDPGSDEAAAWAGILALNPDHDPRTLGAHLAYLRAATRTLLEREWEAVEA
FT                   LAGALVEHETLSGLAATLIIGAHRS"
     MSTNPPPHQP CPAASPTDQV VDERALALAF HESGHAVAAV CLGNAVEAVT IAGGRTHAGL        60
     TLWWSETTDE ARALLKSGGR DADRDLFLRA RGRLEQDVMI TLAGDVAEAL GRLEARWLAT       120
     TRRGELRKSH AGTVQRAPVL ERHVEALAGR DEDRVHARER AASEADDHQE AGLDPGSDEA       180
     AAWAGILALN PDHDPRTLGA HLAYLRAATR TLLEREWEAV EALAGALVEH ETLSGLAATL       240
     IIGAHRS                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page