(data stored in ACNUC1104 zone)

EMBL: CP000509.PE547

CP000509.PE547       Location/Qualifiers
FT   CDS             complement(587200..588729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lxx:Lxx24020 phage-related terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80097"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE62"
FT                   /protein_id="ABL80097.1"
FT                   /translation="MRLLDDPDALVQPSFYHCPDYVVTIGPEVADLVQLFGRTANPEQR
FT                   LLLDGSFGMDRRGRLAAFEVFVEAARQNLKTGFFEFRALGKALLLHRPMQIWTAHKESA
FT                   TDQALLDLKQMIEESAELSKRVKRITEGKGGKSIEFTNRCTIVFRPRTGKAGQSMSADD
FT                   VDLDEYFAVEAKHEGSLLPTMSTRPNAQVGAASSAPHLGSHMQRALMARGRMAALGLRI
FT                   EPRLLYAEWSPIRVIGEKPDGSPRFGPPPCAQPKCTHRLGVEGCIADDREVIKLANPSA
FT                   GRSSKPAISWEFIADERRKLCSPEAPEESLDEYFKERLSIGVEEVGLEASIFPTWPGLK
FT                   QAPPAPLEVLALGVACDNDQTVLSLGAACKGHAHTHLAVVDRRAATERKGFAENVARIQ
FT                   RERSCAVLIRGKNFMIDDLIEAGVTLRLVDADERAQSHADLATAIETNALEHGDYPELN
FT                   AAVEVAQWQVLDNRRSLDSRRGEISALESVALALRGATKPNPTVEPFAIWG"
     MRLLDDPDAL VQPSFYHCPD YVVTIGPEVA DLVQLFGRTA NPEQRLLLDG SFGMDRRGRL        60
     AAFEVFVEAA RQNLKTGFFE FRALGKALLL HRPMQIWTAH KESATDQALL DLKQMIEESA       120
     ELSKRVKRIT EGKGGKSIEF TNRCTIVFRP RTGKAGQSMS ADDVDLDEYF AVEAKHEGSL       180
     LPTMSTRPNA QVGAASSAPH LGSHMQRALM ARGRMAALGL RIEPRLLYAE WSPIRVIGEK       240
     PDGSPRFGPP PCAQPKCTHR LGVEGCIADD REVIKLANPS AGRSSKPAIS WEFIADERRK       300
     LCSPEAPEES LDEYFKERLS IGVEEVGLEA SIFPTWPGLK QAPPAPLEVL ALGVACDNDQ       360
     TVLSLGAACK GHAHTHLAVV DRRAATERKG FAENVARIQR ERSCAVLIRG KNFMIDDLIE       420
     AGVTLRLVDA DERAQSHADL ATAIETNALE HGDYPELNAA VEVAQWQVLD NRRSLDSRRG       480
     EISALESVAL ALRGATKPNP TVEPFAIWG                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page