(data stored in ACNUC1104 zone)

EMBL: CP000509.PE548

CP000509.PE548       Location/Qualifiers
FT   CDS             complement(588726..589163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lxx:Lxx24010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80098"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE63"
FT                   /protein_id="ABL80098.1"
FT                   /translation="MSVDRTCEECGTPFVAKTKRGRFCGAACRVRANRRPTKTGRAVTA
FT                   AAQSGERPAPRVGAADGGLEAQIRSSLESAGAMQTVAGTAALLLARQIGSGQDSGSAVA
FT                   TMTRELSRLMGEARAEAAPKQRDGADDVMARVAAKIQELVR"
     MSVDRTCEEC GTPFVAKTKR GRFCGAACRV RANRRPTKTG RAVTAAAQSG ERPAPRVGAA        60
     DGGLEAQIRS SLESAGAMQT VAGTAALLLA RQIGSGQDSG SAVATMTREL SRLMGEARAE       120
     AAPKQRDGAD DVMARVAAKI QELVR                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page