(data stored in SCRATCH zone)

EMBL: CP000509.PE55

CP000509.PE55        Location/Qualifiers
FT   CDS             complement(62748..63995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0056"
FT                   /product="Glycosyl hydrolase family 32, N terminal domain
FT                   protein"
FT                   /note="PFAM: Glycosyl hydrolase family 32, N terminal
FT                   domain protein; SMART: glycoside hydrolase, family 32;
FT                   KEGG: hma:rrnAC1479 sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79605"
FT                   /db_xref="GOA:A1SCS0"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS0"
FT                   /protein_id="ABL79605.1"
FT                   /translation="MRPLVHFTADAGWINDPHGLTFHRGRYHLFHQYVPESMVWAPNCH
FT                   WGHATSSNLLTWTRHRVAIAPGDGDDGIWTGSLALTGQDATILYTSVAQPDLGLGRVRL
FT                   ATPADDSWEIWSKGDIVVTPPDELDLIAFRDPFVVRDAAGWRMFIGAATREGDALALTY
FT                   TSPDLSSWIYEGIALQRSTKEKDPVWMGALWECPQVFEVDDHWVMVSSVWDNDVLHYAG
FT                   YALGDRDSYSAGKLMPTEWGQLSFGDSYYAPSYFLDEDELPCLMFWMRGVSDADDGWAS
FT                   CLSLPYSLTVRDDRLVAEPHAALAEARGDALAAGADARAYDLEWDPTASQAELVLASDL
FT                   GKSATLRATEGRIHLERPGVDAQSMPWPGGPVRVVVDGPVLEVSCAGGLLGGPIAPATR
FT                   WDGPAEACSAWRLAID"
     MRPLVHFTAD AGWINDPHGL TFHRGRYHLF HQYVPESMVW APNCHWGHAT SSNLLTWTRH        60
     RVAIAPGDGD DGIWTGSLAL TGQDATILYT SVAQPDLGLG RVRLATPADD SWEIWSKGDI       120
     VVTPPDELDL IAFRDPFVVR DAAGWRMFIG AATREGDALA LTYTSPDLSS WIYEGIALQR       180
     STKEKDPVWM GALWECPQVF EVDDHWVMVS SVWDNDVLHY AGYALGDRDS YSAGKLMPTE       240
     WGQLSFGDSY YAPSYFLDED ELPCLMFWMR GVSDADDGWA SCLSLPYSLT VRDDRLVAEP       300
     HAALAEARGD ALAAGADARA YDLEWDPTAS QAELVLASDL GKSATLRATE GRIHLERPGV       360
     DAQSMPWPGG PVRVVVDGPV LEVSCAGGLL GGPIAPATRW DGPAEACSAW RLAID            415
//

If you have problems or comments...

PBIL Back to PBIL home page