(data stored in ACNUC1104 zone)

EMBL: CP000509.PE550

CP000509.PE550       Location/Qualifiers
FT   CDS             complement(590431..591093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80100"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE65"
FT                   /protein_id="ABL80100.1"
FT                   /translation="MGAGNVKAVLTDWSAHVRDPAFRVLVAIALTTKDDDDPPVFWGGL
FT                   ELLAAALGRRAPLTDADLRAVGRAMGQLRKAGAIVRVQHSAPGKAPRHELRIKPSTPDA
FT                   ARLVNQGSTPDARRPVNNGEHRTRGGYSQDAPRPNTGRPASDRGVLGTTEEGASHPPSV
FT                   STGGRSREVVDVTIVDAALHRFEPVSHRPSRCSICDRAAADPRHATPSIELHEAVNT"
     MGAGNVKAVL TDWSAHVRDP AFRVLVAIAL TTKDDDDPPV FWGGLELLAA ALGRRAPLTD        60
     ADLRAVGRAM GQLRKAGAIV RVQHSAPGKA PRHELRIKPS TPDAARLVNQ GSTPDARRPV       120
     NNGEHRTRGG YSQDAPRPNT GRPASDRGVL GTTEEGASHP PSVSTGGRSR EVVDVTIVDA       180
     ALHRFEPVSH RPSRCSICDR AAADPRHATP SIELHEAVNT                             220
//

If you have problems or comments...

PBIL Back to PBIL home page