(data stored in ACNUC1104 zone)

EMBL: CP000509.PE552

CP000509.PE552       Location/Qualifiers
FT   CDS             complement(591317..591718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80102"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE67"
FT                   /protein_id="ABL80102.1"
FT                   /translation="MAHSAGDIRPAATAVPSAHRSPGLERVADSWPAADVSAAAFHMHA
FT                   LGMSESVSALALRTLAARGVRNVRAYVAPWTADDASRWTQRANEVQCDAERAACHLKIG
FT                   HHQDPLIRGLRRRVARWPWRTSTGGDRGV"
     MAHSAGDIRP AATAVPSAHR SPGLERVADS WPAADVSAAA FHMHALGMSE SVSALALRTL        60
     AARGVRNVRA YVAPWTADDA SRWTQRANEV QCDAERAACH LKIGHHQDPL IRGLRRRVAR       120
     WPWRTSTGGD RGV                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page