(data stored in ACNUC1104 zone)

EMBL: CP000509.PE553

CP000509.PE553       Location/Qualifiers
FT   CDS             complement(591718..591897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0561"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   KEGG: mmc:Mmcs_4829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80103"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE68"
FT                   /protein_id="ABL80103.1"
FT                   /translation="MPDYLTTAEVADILRTPVETVRFWRHAHKGPKSFKVGRRVLYARE
FT                   DVERFIAEARGTTG"
     MPDYLTTAEV ADILRTPVET VRFWRHAHKG PKSFKVGRRV LYAREDVERF IAEARGTTG         59
//

If you have problems or comments...

PBIL Back to PBIL home page