(data stored in ACNUC1104 zone)

EMBL: CP000509.PE554

CP000509.PE554       Location/Qualifiers
FT   CDS             591983..592798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80104"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE69"
FT                   /protein_id="ABL80104.1"
FT                   /translation="MTPSTQEEIWFRAGRIIRPKDPVVRDGNVIWAEEYDGKAPRAPGP
FT                   DDLLDRYCRLAIATHEEIAEFVALNGLPEVGGFVMLGEEKAPDWRQRFPDEPGRVPADR
FT                   IREHARGVAAARRVGAALAGRRPGDQADWLDMHRFLNPGKRRLASRPGWLGQELGDWSL
FT                   ERDRFAGLVSDFLASTGVYTGVNWSDYKRLAIVPVSSTFLGAIALLLSREIGAEGRYAC
FT                   SSCGSPVDRRRPPRAGESVYCDRPECKREQQRRNQAAWRAKKAAERGGS"
     MTPSTQEEIW FRAGRIIRPK DPVVRDGNVI WAEEYDGKAP RAPGPDDLLD RYCRLAIATH        60
     EEIAEFVALN GLPEVGGFVM LGEEKAPDWR QRFPDEPGRV PADRIREHAR GVAAARRVGA       120
     ALAGRRPGDQ ADWLDMHRFL NPGKRRLASR PGWLGQELGD WSLERDRFAG LVSDFLASTG       180
     VYTGVNWSDY KRLAIVPVSS TFLGAIALLL SREIGAEGRY ACSSCGSPVD RRRPPRAGES       240
     VYCDRPECKR EQQRRNQAAW RAKKAAERGG S                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page