(data stored in ACNUC1104 zone)

EMBL: CP000509.PE556

CP000509.PE556       Location/Qualifiers
FT   CDS             complement(594467..594958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0564"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   mpa:MAP4063c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80106"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE71"
FT                   /protein_id="ABL80106.1"
FT                   /translation="MADSSFDIVSKIDRQEVDNALGQTAREIATRFDFKGTGASIEWQG
FT                   EHAIEISASADDRASAVLDVFKTKLVKRDVSLKVLDASEPRQSGQQSKIAIALKEGISS
FT                   EDAKKISKLIRDEGPKGVKAQIQGDELRVSSKKRDDLQAVIALVKQQDYDFAVQFTNYR
FT                   "
     MADSSFDIVS KIDRQEVDNA LGQTAREIAT RFDFKGTGAS IEWQGEHAIE ISASADDRAS        60
     AVLDVFKTKL VKRDVSLKVL DASEPRQSGQ QSKIAIALKE GISSEDAKKI SKLIRDEGPK       120
     GVKAQIQGDE LRVSSKKRDD LQAVIALVKQ QDYDFAVQFT NYR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page