(data stored in ACNUC1104 zone)

EMBL: CP000509.PE558

CP000509.PE558       Location/Qualifiers
FT   CDS             complement(596887..597114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5348 excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80108"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE73"
FT                   /protein_id="ABL80108.1"
FT                   /translation="MDLPTNSDTVPSPAATEHLLTVPEICARLGVSRSTFYDWRQAHKA
FT                   PPCLVLPNAQLRVREADFDRWVDERMETAL"
     MDLPTNSDTV PSPAATEHLL TVPEICARLG VSRSTFYDWR QAHKAPPCLV LPNAQLRVRE        60
     ADFDRWVDER METAL                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page