(data stored in ACNUC1104 zone)

EMBL: CP000509.PE562

CP000509.PE562       Location/Qualifiers
FT   CDS             complement(599689..600102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0570"
FT                   /product="single-strand binding protein/Primosomal
FT                   replication protein n"
FT                   /note="PFAM: single-strand binding protein/Primosomal
FT                   replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80112"
FT                   /db_xref="GOA:A1SE77"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE77"
FT                   /protein_id="ABL80112.1"
FT                   /translation="MSMPTQMSLVGFIASAPELHFTKAGAECCRMRVGIEQWRKEVDGS
FT                   FTKLDPTFHDMVAFESTARETYARFRKGDSFVASGYVHEYEVDGREGSVIKEEFVARKI
FT                   GHNVSKTDYVVQRGRHAADRSLTSVPQPPAVGL"
     MSMPTQMSLV GFIASAPELH FTKAGAECCR MRVGIEQWRK EVDGSFTKLD PTFHDMVAFE        60
     STARETYARF RKGDSFVASG YVHEYEVDGR EGSVIKEEFV ARKIGHNVSK TDYVVQRGRH       120
     AADRSLTSVP QPPAVGL                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page