(data stored in ACNUC1104 zone)

EMBL: CP000509.PE563

CP000509.PE563       Location/Qualifiers
FT   CDS             600243..600554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0571"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   cef:CE2618 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80113"
FT                   /db_xref="GOA:A1SE78"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE78"
FT                   /protein_id="ABL80113.1"
FT                   /translation="MPKKIDPAVKERCVRQVLEHLPEYPSLTAAAESVARREGLGKETV
FT                   RRWVVQAQIDGGQRQGATSEELAEIKELKAKVRRLEEDNEILRRASIFFAGELDPRNR"
     MPKKIDPAVK ERCVRQVLEH LPEYPSLTAA AESVARREGL GKETVRRWVV QAQIDGGQRQ        60
     GATSEELAEI KELKAKVRRL EEDNEILRRA SIFFAGELDP RNR                         103
//

If you have problems or comments...

PBIL Back to PBIL home page