(data stored in ACNUC1104 zone)

EMBL: CP000509.PE565

CP000509.PE565       Location/Qualifiers
FT   CDS             603183..604172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0574"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="KEGG: tfu:Tfu_1348 elongator protein 3/MiaB/NifB;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein A; PFAM:
FT                   Radical SAM domain protein; molybdenum cofactor synthesis
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80115"
FT                   /db_xref="GOA:A1SE80"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE80"
FT                   /protein_id="ABL80115.1"
FT                   /translation="MTAPLADRFGRVAADLRVSLTDRCNLRCNYCMPAEGLDWLPTEQT
FT                   LTDDEIVRLITIGVEMLGIREVRFTGGEPLLRRGLVDIVARTHALGVETSLTTNALGLA
FT                   RTAQALADARLDRINASIDTVRPDTFATITRRDRLHDVVAGLEAAKSAGLGPIKLNAVL
FT                   LRGTNDDQAPELLRWSIEHGYELRFIEQMPLDAQHDWSRAEMVTADEIFDALSTEFSLT
FT                   PHGEPRGSAPAELFDVGGGPATVGIIASVTRPFCGDCDRVRLTADGQVRNCLFAREESD
FT                   LRTALRSGATDQEIAERWVIAMLGKRAGHGIDDMTFLQPDRPMSAIGG"
     MTAPLADRFG RVAADLRVSL TDRCNLRCNY CMPAEGLDWL PTEQTLTDDE IVRLITIGVE        60
     MLGIREVRFT GGEPLLRRGL VDIVARTHAL GVETSLTTNA LGLARTAQAL ADARLDRINA       120
     SIDTVRPDTF ATITRRDRLH DVVAGLEAAK SAGLGPIKLN AVLLRGTNDD QAPELLRWSI       180
     EHGYELRFIE QMPLDAQHDW SRAEMVTADE IFDALSTEFS LTPHGEPRGS APAELFDVGG       240
     GPATVGIIAS VTRPFCGDCD RVRLTADGQV RNCLFAREES DLRTALRSGA TDQEIAERWV       300
     IAMLGKRAGH GIDDMTFLQP DRPMSAIGG                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page