(data stored in ACNUC1104 zone)

EMBL: CP000509.PE567

CP000509.PE567       Location/Qualifiers
FT   CDS             606498..607802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0576"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; NmrA
FT                   family protein; protein of unknown function DUF1486; KEGG:
FT                   nfa:nfa29880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80117"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE82"
FT                   /protein_id="ABL80117.1"
FT                   /translation="MSQILVIGARGKTGRHVASGLVSRGVSVKAASRNPEEVSGGHGVP
FT                   TRFDWHDSSTWRSALAGIDAVYLVKPESEDVVEIVTEFLHAMGDAGVRRLVLLSECATH
FT                   TRSEDATERRVELAVEATDLEWTILRPSWFMQDIIAEDFFGPMIRDGGIIVMTTGGSAT
FT                   AWIDVRDIAEVAVELLIGGGSIGQAVDLTGPEALTLNELAERITAAAGTPVLGVEETVA
FT                   EAESRMRRDGFDEDTIAYLTRIVESIIEGHTANVTGDVERITGHPPRHFDSFLVDHARD
FT                   LRRTGDLDADNTRPDAAADNEALFRRLVAAWASSDFDTLLDCFADDMVYTDMPFPDAPV
FT                   QGKTAFKRHVTDYNALFARGQVDTELVTVVATDTHVVGELSCRASYVGPGAPAEGVPVH
FT                   WYATLVDTIDDGKVVSEHAYFDPTAFDKAIQRVST"
     MSQILVIGAR GKTGRHVASG LVSRGVSVKA ASRNPEEVSG GHGVPTRFDW HDSSTWRSAL        60
     AGIDAVYLVK PESEDVVEIV TEFLHAMGDA GVRRLVLLSE CATHTRSEDA TERRVELAVE       120
     ATDLEWTILR PSWFMQDIIA EDFFGPMIRD GGIIVMTTGG SATAWIDVRD IAEVAVELLI       180
     GGGSIGQAVD LTGPEALTLN ELAERITAAA GTPVLGVEET VAEAESRMRR DGFDEDTIAY       240
     LTRIVESIIE GHTANVTGDV ERITGHPPRH FDSFLVDHAR DLRRTGDLDA DNTRPDAAAD       300
     NEALFRRLVA AWASSDFDTL LDCFADDMVY TDMPFPDAPV QGKTAFKRHV TDYNALFARG       360
     QVDTELVTVV ATDTHVVGEL SCRASYVGPG APAEGVPVHW YATLVDTIDD GKVVSEHAYF       420
     DPTAFDKAIQ RVST                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page