(data stored in SCRATCH zone)

EMBL: CP000509.PE574

CP000509.PE574       Location/Qualifiers
FT   CDS             620470..620763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80124"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE89"
FT                   /protein_id="ABL80124.1"
FT                   /translation="MVKTALKRAGNAVVVWKSADRCEIHPVQIHTSPRRRRSRKGSLID
FT                   WGEAIGEVEVIEVNVPDLAVFKALHDGIIDVMTERPDCQGKTQVSDCGPGRE"
     MVKTALKRAG NAVVVWKSAD RCEIHPVQIH TSPRRRRSRK GSLIDWGEAI GEVEVIEVNV        60
     PDLAVFKALH DGIIDVMTER PDCQGKTQVS DCGPGRE                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page