(data stored in ACNUC1104 zone)

EMBL: CP000509.PE575

CP000509.PE575       Location/Qualifiers
FT   CDS             621282..622454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0588"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: fal:FRAAL2528 hypothetical protein; TC
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80125"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE90"
FT                   /protein_id="ABL80125.1"
FT                   /translation="MHKTLGTRVRRLAGAVLVLAVMGVISSCSTESGGQAASASSDDNV
FT                   AQAANEAIDKLYGNGTFTEPASTGPKAQSGYKVALVSSGVQSPTGTAMANGARAAAKLL
FT                   GWDFTVYDGKYEPAEYQEGIRQAISQNADAIWLYSIDCPLVRTALEEAKKAGIPVFSQE
FT                   AADCSDVDPSQPSYYERSLEFVEGDFITWGEGLGAAEATWLLSKLGSEANIIEVSNTEL
FT                   VITKAVHDGFQKAMKEQCPECEVATLNIRLADFGPALEEKISTALLRNPEANGMALSYD
FT                   DLVTSGGAAAVMASGRNDSIEVVSGSGYAANIDLVRQNKGQDAGWTYDGSYEAWSAADM
FT                   INRYFAGEERVPSGVGISMFDHDHDLPPEGEAWSTSIDYEPVFKKVWGVS"
     MHKTLGTRVR RLAGAVLVLA VMGVISSCST ESGGQAASAS SDDNVAQAAN EAIDKLYGNG        60
     TFTEPASTGP KAQSGYKVAL VSSGVQSPTG TAMANGARAA AKLLGWDFTV YDGKYEPAEY       120
     QEGIRQAISQ NADAIWLYSI DCPLVRTALE EAKKAGIPVF SQEAADCSDV DPSQPSYYER       180
     SLEFVEGDFI TWGEGLGAAE ATWLLSKLGS EANIIEVSNT ELVITKAVHD GFQKAMKEQC       240
     PECEVATLNI RLADFGPALE EKISTALLRN PEANGMALSY DDLVTSGGAA AVMASGRNDS       300
     IEVVSGSGYA ANIDLVRQNK GQDAGWTYDG SYEAWSAADM INRYFAGEER VPSGVGISMF       360
     DHDHDLPPEG EAWSTSIDYE PVFKKVWGVS                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page