(data stored in ACNUC1104 zone)

EMBL: CP000509.PE576

CP000509.PE576       Location/Qualifiers
FT   CDS             622577..623803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80126"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE91"
FT                   /protein_id="ABL80126.1"
FT                   /translation="MSIEHDLRAVADELILKIPAISEEVRERCRSGAPNYYRRNDPMLL
FT                   ETELPSITGALTSIIHGLRHARQLPDGASEGALEEARVAAQAGVELTDLLLTRRIGQVV
FT                   LWNWILETAVRIVPAGPRQMAVLKQAAEYHFAWNDRITHDVVATYEQEKSAYFFHSRDR
FT                   QRRAVVTDLLNGVPTDTEQLGYNLKVDHLAAVVWGSAPRVALKSLATLFEASLLVVEGT
FT                   GGTSLAWLGSSRLCESFEQRYETFQPPAATFVAVGGPLNGVDGFRRAHRQAWQACRVGR
FT                   LRSEPVTRYRDIALESVVLRDAPAARDFMMSELGPIGDDDARTQLLRETLKAYFDTGQN
FT                   AAATAGRIRVHERTVAYRLKSIEERLGFPISDRRDELAVALRLAGVLHEASDRQLSILG
FT                   ENSQGETGI"
     MSIEHDLRAV ADELILKIPA ISEEVRERCR SGAPNYYRRN DPMLLETELP SITGALTSII        60
     HGLRHARQLP DGASEGALEE ARVAAQAGVE LTDLLLTRRI GQVVLWNWIL ETAVRIVPAG       120
     PRQMAVLKQA AEYHFAWNDR ITHDVVATYE QEKSAYFFHS RDRQRRAVVT DLLNGVPTDT       180
     EQLGYNLKVD HLAAVVWGSA PRVALKSLAT LFEASLLVVE GTGGTSLAWL GSSRLCESFE       240
     QRYETFQPPA ATFVAVGGPL NGVDGFRRAH RQAWQACRVG RLRSEPVTRY RDIALESVVL       300
     RDAPAARDFM MSELGPIGDD DARTQLLRET LKAYFDTGQN AAATAGRIRV HERTVAYRLK       360
     SIEERLGFPI SDRRDELAVA LRLAGVLHEA SDRQLSILGE NSQGETGI                    408
//

If you have problems or comments...

PBIL Back to PBIL home page