(data stored in SCRATCH zone)

EMBL: CP000509.PE577

CP000509.PE577       Location/Qualifiers
FT   CDS             623979..624278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0590"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel domain
FT                   protein; KEGG: mmp:MMP0887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80127"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE92"
FT                   /protein_id="ABL80127.1"
FT                   /translation="MIRHVFSWRVAEGHSNDEIIEILNTLPGALPVIKYWEVGSHQGDP
FT                   GDNGDPFDGVLITDFDSWDDLDAYSNDPFHLSVVERLLPRFSARAVVDFERKDA"
     MIRHVFSWRV AEGHSNDEII EILNTLPGAL PVIKYWEVGS HQGDPGDNGD PFDGVLITDF        60
     DSWDDLDAYS NDPFHLSVVE RLLPRFSARA VVDFERKDA                               99
//

If you have problems or comments...

PBIL Back to PBIL home page