(data stored in ACNUC1104 zone)

EMBL: CP000509.PE578

CP000509.PE578       Location/Qualifiers
FT   CDS             624278..625204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0591"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: pfl:PFL_4035
FT                   hypothetical polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80128"
FT                   /db_xref="GOA:A1SE93"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE93"
FT                   /protein_id="ABL80128.1"
FT                   /translation="MDRAGIKVAASPWGPDDQLGALNHLSREGSAAILARVDGTRSYDL
FT                   SIDYFVGMPSFQAAGDPSYQLFMSHTPAGTVVDNMNGVGEAGNRHVCYSGDVVFMYTHT
FT                   GTHIDSLSHFGVDGHIYNGFSVEDNLGSRGWTKGGAEVIPPIITRGVLIDVAKSHQVDC
FT                   LPDSYAITVEDCQKVLNDAGITLQPGDVALIRTGRMGFWPDGSKVLGNPPGLSLEAAKW
FT                   LTRQGISAIAADQECVEVGPSQHEDNWLPGHCHFLAEAGVPMIELVNLEELSRDGVDEF
FT                   CLIAAPIRLRGASGAPLRPIALPLRDN"
     MDRAGIKVAA SPWGPDDQLG ALNHLSREGS AAILARVDGT RSYDLSIDYF VGMPSFQAAG        60
     DPSYQLFMSH TPAGTVVDNM NGVGEAGNRH VCYSGDVVFM YTHTGTHIDS LSHFGVDGHI       120
     YNGFSVEDNL GSRGWTKGGA EVIPPIITRG VLIDVAKSHQ VDCLPDSYAI TVEDCQKVLN       180
     DAGITLQPGD VALIRTGRMG FWPDGSKVLG NPPGLSLEAA KWLTRQGISA IAADQECVEV       240
     GPSQHEDNWL PGHCHFLAEA GVPMIELVNL EELSRDGVDE FCLIAAPIRL RGASGAPLRP       300
     IALPLRDN                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page