(data stored in SCRATCH zone)

EMBL: CP000509.PE579

CP000509.PE579       Location/Qualifiers
FT   CDS             625236..626420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0592"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG:
FT                   bur:Bcep18194_A4962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80129"
FT                   /db_xref="GOA:A1SE94"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE94"
FT                   /protein_id="ABL80129.1"
FT                   /translation="MSMPKVGVVGGSIAGLTAANLLRDAGCEVDVYERSDTLLSGFGTG
FT                   IVVQPELVRYLLERTSTALEDISVPSNEMRYFDAASGRSAGQVKAGWRFTAYNAVYQKL
FT                   LDAFGTERYHLGKELVLVTPGAETATATFADGAQVTADLLVCADGGGSVARSQLLGRKP
FT                   DYAGYVTWRGMVDQSDVSTETWDFFQDAFTYGLLPDGHIIAYPISQVSSEGEVTGDTRL
FT                   NFQWYWNVEAGEALDELMTANDGNRRPVSVHFPALPASSLEEFRSRATSQLAPNFRELI
FT                   TGAPQPFVTIVADADVPRMAFDRLALIGDAAFTPRPHAAAGAAKAAADAWALADRLVEA
FT                   SGDVQEALAAWEPERLAVGEAYLAKVRAMAAALQHGGEFPPGAAEFRFGLPRPA"
     MSMPKVGVVG GSIAGLTAAN LLRDAGCEVD VYERSDTLLS GFGTGIVVQP ELVRYLLERT        60
     STALEDISVP SNEMRYFDAA SGRSAGQVKA GWRFTAYNAV YQKLLDAFGT ERYHLGKELV       120
     LVTPGAETAT ATFADGAQVT ADLLVCADGG GSVARSQLLG RKPDYAGYVT WRGMVDQSDV       180
     STETWDFFQD AFTYGLLPDG HIIAYPISQV SSEGEVTGDT RLNFQWYWNV EAGEALDELM       240
     TANDGNRRPV SVHFPALPAS SLEEFRSRAT SQLAPNFREL ITGAPQPFVT IVADADVPRM       300
     AFDRLALIGD AAFTPRPHAA AGAAKAAADA WALADRLVEA SGDVQEALAA WEPERLAVGE       360
     AYLAKVRAMA AALQHGGEFP PGAAEFRFGL PRPA                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page