(data stored in ACNUC1104 zone)

EMBL: CP000509.PE580

CP000509.PE580       Location/Qualifiers
FT   CDS             626505..627239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0593"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   mmc:Mmcs_4601 carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80130"
FT                   /db_xref="GOA:A1SE95"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE95"
FT                   /protein_id="ABL80130.1"
FT                   /translation="MQLLNEFEVALPPENTWTLLTDLEKVAPCLPGASITSVEGDDFHG
FT                   RAKIKVGPITAEYKGVAQFTELDEKAHTAVLLARGKDARGQGDATANVRATLHPKGAGT
FT                   RVVVETELALTGKVAQFGRGVLADVSGALMTMFAQRLQEMVAAEGAPDTPTSAAAATDD
FT                   RDAQHQAAEAPAHPAASASSSRVGGRVSDRDDEVLDILALAGGMSWAKAIPTGGALVSV
FT                   VAALISVFAAGYASGRARSANR"
     MQLLNEFEVA LPPENTWTLL TDLEKVAPCL PGASITSVEG DDFHGRAKIK VGPITAEYKG        60
     VAQFTELDEK AHTAVLLARG KDARGQGDAT ANVRATLHPK GAGTRVVVET ELALTGKVAQ       120
     FGRGVLADVS GALMTMFAQR LQEMVAAEGA PDTPTSAAAA TDDRDAQHQA AEAPAHPAAS       180
     ASSSRVGGRV SDRDDEVLDI LALAGGMSWA KAIPTGGALV SVVAALISVF AAGYASGRAR       240
     SANR                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page