(data stored in ACNUC1104 zone)

EMBL: CP000509.PE582

CP000509.PE582       Location/Qualifiers
FT   CDS             628127..628633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0595"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: rxy:Rxyl_1873 (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80132"
FT                   /db_xref="GOA:A1SE97"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE97"
FT                   /protein_id="ABL80132.1"
FT                   /translation="MSTTPEERLDVSMTINGSRYRATVEARRTLADFIREDAQLPGTKL
FT                   GCEHGVCGACTVLLDDLPARSCLTLAVQAEGRQIRTVESLADGQELNHLQRAFREQHGL
FT                   QCGFCTAGFLMTATALLEENATPTREEIVETMSGSLCRCTGYQTIISAIEQAAAEGQSD
FT                   TEDDQ"
     MSTTPEERLD VSMTINGSRY RATVEARRTL ADFIREDAQL PGTKLGCEHG VCGACTVLLD        60
     DLPARSCLTL AVQAEGRQIR TVESLADGQE LNHLQRAFRE QHGLQCGFCT AGFLMTATAL       120
     LEENATPTRE EIVETMSGSL CRCTGYQTII SAIEQAAAEG QSDTEDDQ                    168
//

If you have problems or comments...

PBIL Back to PBIL home page