(data stored in ACNUC1104 zone)

EMBL: CP000509.PE583

CP000509.PE583       Location/Qualifiers
FT   CDS             628630..631035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0596"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: rxy:Rxyl_1872
FT                   carbon-monoxide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80133"
FT                   /db_xref="GOA:A1SE98"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE98"
FT                   /protein_id="ABL80133.1"
FT                   /translation="MKKLDSHQHMKTPVVAARSVGTRVLRSEDPRLLTGRGEFIADIDL
FT                   PRQLHVAFIRSPVAHARITNLDLSAIRDADGVALAWSGKDVAPFCEGLVGEMAVEGCFP
FT                   TTMPLLAGDEVVYVGEPVAVVVADSRYAAEDACELIDWDFDELPAVTNVDAAAGGGPVA
FT                   NPQLPDNIGLNGGASFGDVSGAFEQAHQVVEGRFYTCRVSAAPMETRGVIADYEWASKA
FT                   LRLWSNTQMPHYLKYMLTAYLGFPEQSVEVITPDTGGGFGLKAHVYPEEMLLPLIAREV
FT                   GRPVKWIEDRRENLIAGAHAHEQYVDIAYALDADGKITGVRTHALGDGGAYHLPPWSMA
FT                   VEPWCAAVMTPTGIYDVPAVEYTYKAAATNKTPVGAYRGVGYMAGTFARECLADDAARA
FT                   LRMSPFDFRRHNVVREFPWTNPQGIVYQEGSWLQTIDALEEMVDYPAFLRRQTELRKEG
FT                   RYIGLGLSCFVESSGESTATSLEHGLGDVYHDTATVRLNPNGTANVTIGLSAQGQGLAT
FT                   TMAQMAADTLGIKVEDVSVQTARSTSHAYGSGTLGSRGAVVAGGAVSRAADVVREKVRQ
FT                   VAAHMLEASTDDIELVDGLASIKGISDASLSIADVATAIYFDLDSWPEDFEPTLEATQA
FT                   YDPSQAMFSNGGHAIMVELDAETGFVRFEKIFSVEDCGTVINPNIVEGQIRGGVIQGIG
FT                   ASVFEELAYDESGQILTTTFLDYGLPTMDVAPPFEINHLETPSSHSASGVKGMGESGLI
FT                   AAPAAVLNAVNDALSPFGVVLRDLPLTPEKVLGAMSGAKVATGLAERS"
     MKKLDSHQHM KTPVVAARSV GTRVLRSEDP RLLTGRGEFI ADIDLPRQLH VAFIRSPVAH        60
     ARITNLDLSA IRDADGVALA WSGKDVAPFC EGLVGEMAVE GCFPTTMPLL AGDEVVYVGE       120
     PVAVVVADSR YAAEDACELI DWDFDELPAV TNVDAAAGGG PVANPQLPDN IGLNGGASFG       180
     DVSGAFEQAH QVVEGRFYTC RVSAAPMETR GVIADYEWAS KALRLWSNTQ MPHYLKYMLT       240
     AYLGFPEQSV EVITPDTGGG FGLKAHVYPE EMLLPLIARE VGRPVKWIED RRENLIAGAH       300
     AHEQYVDIAY ALDADGKITG VRTHALGDGG AYHLPPWSMA VEPWCAAVMT PTGIYDVPAV       360
     EYTYKAAATN KTPVGAYRGV GYMAGTFARE CLADDAARAL RMSPFDFRRH NVVREFPWTN       420
     PQGIVYQEGS WLQTIDALEE MVDYPAFLRR QTELRKEGRY IGLGLSCFVE SSGESTATSL       480
     EHGLGDVYHD TATVRLNPNG TANVTIGLSA QGQGLATTMA QMAADTLGIK VEDVSVQTAR       540
     STSHAYGSGT LGSRGAVVAG GAVSRAADVV REKVRQVAAH MLEASTDDIE LVDGLASIKG       600
     ISDASLSIAD VATAIYFDLD SWPEDFEPTL EATQAYDPSQ AMFSNGGHAI MVELDAETGF       660
     VRFEKIFSVE DCGTVINPNI VEGQIRGGVI QGIGASVFEE LAYDESGQIL TTTFLDYGLP       720
     TMDVAPPFEI NHLETPSSHS ASGVKGMGES GLIAAPAAVL NAVNDALSPF GVVLRDLPLT       780
     PEKVLGAMSG AKVATGLAER S                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page