(data stored in ACNUC1104 zone)

EMBL: CP000509.PE585

CP000509.PE585       Location/Qualifiers
FT   CDS             complement(634392..635381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0600"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   eba:p2A227 putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80135"
FT                   /db_xref="GOA:A1SEA0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA0"
FT                   /protein_id="ABL80135.1"
FT                   /translation="MNALAASLQTYFTTFARSQRDLSNHTIGSYRDTWRMLLKYLTTTL
FT                   GVSVDAVDFDAVTATNITRFLDYLEHERGNSAKTRNVRLTAIRAVLGHALPDHPEHAAT
FT                   ITQVLAIPPKRTTRPVIEFLRPDEVVALLAAPDPTTRTGRRDHALLAMTVQTGLRISEV
FT                   CSLTIDDVHLGTGPHVTCTGKGRRRRITPLTGATVSVMTDYLTERSARPGTALFCGPRG
FT                   LSLSRDALEHRLATHVAAAAAACPSLTGKHVTMHTLRHTAAMNLLAAGVDVAVIALWLG
FT                   HADTHSTDGYLHADMAIKQAALDRTRPPDVQAGTYRPAPDILTWLTAL"
     MNALAASLQT YFTTFARSQR DLSNHTIGSY RDTWRMLLKY LTTTLGVSVD AVDFDAVTAT        60
     NITRFLDYLE HERGNSAKTR NVRLTAIRAV LGHALPDHPE HAATITQVLA IPPKRTTRPV       120
     IEFLRPDEVV ALLAAPDPTT RTGRRDHALL AMTVQTGLRI SEVCSLTIDD VHLGTGPHVT       180
     CTGKGRRRRI TPLTGATVSV MTDYLTERSA RPGTALFCGP RGLSLSRDAL EHRLATHVAA       240
     AAAACPSLTG KHVTMHTLRH TAAMNLLAAG VDVAVIALWL GHADTHSTDG YLHADMAIKQ       300
     AALDRTRPPD VQAGTYRPAP DILTWLTAL                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page