(data stored in SCRATCH zone)

EMBL: CP000509.PE587

CP000509.PE587       Location/Qualifiers
FT   CDS             complement(636373..637611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0602"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   eba:p2A229 putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80137"
FT                   /db_xref="GOA:A1SEA2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA2"
FT                   /protein_id="ABL80137.1"
FT                   /translation="MTKRSATARPYPVRIQRVPVGPLAPTVLDECRRWFAAKGYSPGSA
FT                   AAAVNLAQRLSAWMELAGAGIDEIDEDLLDRFVTAERSRERPCSSVKPWIGALRRCLTD
FT                   SGYLQADGVDEDRSTPTQVAAAQWCEWMRVQRGLTEKSIVRYRYYAVGLLDQVTTADGS
FT                   VSWDRLNATMINAYVADRGRGYGVAAKAHVVGSVRCLLRWALSTGRLDRDLSAGILKPS
FT                   GTKRSLPRGVTADQVAALLAVCDPTTAIGARDRALVLMLVRLGLRAGEAAHLMLDDIDW
FT                   AGGQVRVTGKGREHVLPLPVDVGQALEAWLRLRPEALDRAVFVRLRAPRQMMTASGTSG
FT                   VIARLSSMAGIEPIHAHRLRHTAAMDVLAAGGTLSEAKELLGHVYTVTTMTYAKVDLAS
FT                   LRELVVPFGQVPR"
     MTKRSATARP YPVRIQRVPV GPLAPTVLDE CRRWFAAKGY SPGSAAAAVN LAQRLSAWME        60
     LAGAGIDEID EDLLDRFVTA ERSRERPCSS VKPWIGALRR CLTDSGYLQA DGVDEDRSTP       120
     TQVAAAQWCE WMRVQRGLTE KSIVRYRYYA VGLLDQVTTA DGSVSWDRLN ATMINAYVAD       180
     RGRGYGVAAK AHVVGSVRCL LRWALSTGRL DRDLSAGILK PSGTKRSLPR GVTADQVAAL       240
     LAVCDPTTAI GARDRALVLM LVRLGLRAGE AAHLMLDDID WAGGQVRVTG KGREHVLPLP       300
     VDVGQALEAW LRLRPEALDR AVFVRLRAPR QMMTASGTSG VIARLSSMAG IEPIHAHRLR       360
     HTAAMDVLAA GGTLSEAKEL LGHVYTVTTM TYAKVDLASL RELVVPFGQV PR               412
//

If you have problems or comments...

PBIL Back to PBIL home page