(data stored in SCRATCH zone)

EMBL: CP000509.PE590

CP000509.PE590       Location/Qualifiers
FT   CDS             complement(641063..641557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0606"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: gka:GKP18 carbon monoxide dehydrogenase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80140"
FT                   /db_xref="GOA:A1SEA5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA5"
FT                   /protein_id="ABL80140.1"
FT                   /translation="MKTRVTVNGEGYERDVEPRMLLSDFLRHELGLTGTNVGCEHGVCG
FT                   SCTVLLDGEPVRSCTMLAVQCDSRRLTTVEGLACDEKLHGLQDAFSACHGLQCGFCTPG
FT                   MLMTLLPIYNEARRLNDDEIREAISGNLCRCTGYQQIVEAARKALGEAADMADPCVESR
FT                   A"
     MKTRVTVNGE GYERDVEPRM LLSDFLRHEL GLTGTNVGCE HGVCGSCTVL LDGEPVRSCT        60
     MLAVQCDSRR LTTVEGLACD EKLHGLQDAF SACHGLQCGF CTPGMLMTLL PIYNEARRLN       120
     DDEIREAISG NLCRCTGYQQ IVEAARKALG EAADMADPCV ESRA                        164
//

If you have problems or comments...

PBIL Back to PBIL home page