(data stored in ACNUC1104 zone)

EMBL: CP000509.PE592

CP000509.PE592       Location/Qualifiers
FT   CDS             complement(642623..643873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0608"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /note="KEGG: rha:RHA1_ro03774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80142"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA7"
FT                   /protein_id="ABL80142.1"
FT                   /translation="MTIESDLQVVANAVRARIPELVSAIERTSAQEVPEIYEKDDPVYK
FT                   EAERSSVLSALTSIVEGLAGGRRPPDRPSDAALQEARIAAQAGIDLHSLLRTYRVGQSI
FT                   LWDAILEETLHVVDSDERRMAVLKQASDYQYGWNNKVMESVIAAYQAEHNAYFFRSQDR
FT                   KRRAVVSDILRGIPADVQQLGYSLRAEHLAVVAWGRSPEANIRALAVSLDARHLTVSGT
FT                   SGTYLGWLGSSSLKRVLVERPEAARAMRETHLALGEVAHGIDGFRLSHRQAWQAYRVGK
FT                   LRAAGLVNYADVALEALMLKDRQAVQDFVSRELGPLHDEEDPRGELLKSTLRAYFRSGQ
FT                   NAASTAQAIHVHERTVAYRLRSIESRLGVTIGARRDELAAALRLADLLGQVSSADLRDL
FT                   DAQADAGLGPDPEAAAQ"
     MTIESDLQVV ANAVRARIPE LVSAIERTSA QEVPEIYEKD DPVYKEAERS SVLSALTSIV        60
     EGLAGGRRPP DRPSDAALQE ARIAAQAGID LHSLLRTYRV GQSILWDAIL EETLHVVDSD       120
     ERRMAVLKQA SDYQYGWNNK VMESVIAAYQ AEHNAYFFRS QDRKRRAVVS DILRGIPADV       180
     QQLGYSLRAE HLAVVAWGRS PEANIRALAV SLDARHLTVS GTSGTYLGWL GSSSLKRVLV       240
     ERPEAARAMR ETHLALGEVA HGIDGFRLSH RQAWQAYRVG KLRAAGLVNY ADVALEALML       300
     KDRQAVQDFV SRELGPLHDE EDPRGELLKS TLRAYFRSGQ NAASTAQAIH VHERTVAYRL       360
     RSIESRLGVT IGARRDELAA ALRLADLLGQ VSSADLRDLD AQADAGLGPD PEAAAQ           416
//

If you have problems or comments...

PBIL Back to PBIL home page