(data stored in ACNUC1104 zone)

EMBL: CP000509.PE594

CP000509.PE594       Location/Qualifiers
FT   CDS             complement(644690..645766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0610"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   fal:FRAAL2526 putative ribose transport system permease
FT                   protein; putative membrane protein; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80144"
FT                   /db_xref="GOA:A1SEA9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA9"
FT                   /protein_id="ABL80144.1"
FT                   /translation="MSHTQDTTDAPVASPDAETLPAPTGVAEAEQKRKAARARTGKARF
FT                   VDFLEAYALLVLLVVIALFFCFWPETSSTFPTVANMRILLASQAVIGVISLGLLLPLLC
FT                   QEFDLSVGNIAGLAAIVVAAYVSSEGNVLAAVVLALTIGLAIGAVNALIVTRLHVNGVI
FT                   ATLGMSTILGGIVLQRTGGLAPASDIPQSLTNFGTGLVAGVPIIFITLLVIAGITYFVL
FT                   NHTSLGRQIYAVGSNMEAAKLVGLRTDGLRAVTFAAGGLLCGLGGLLYVSRAGGASPNV
FT                   GMTFTLPAFAAAFLSAASVRPGRFNVWGTIIAVYFLAVLNNGLSLAGVDPYVNDYVNGG
FT                   ALIAGVALATVLYRRRTT"
     MSHTQDTTDA PVASPDAETL PAPTGVAEAE QKRKAARART GKARFVDFLE AYALLVLLVV        60
     IALFFCFWPE TSSTFPTVAN MRILLASQAV IGVISLGLLL PLLCQEFDLS VGNIAGLAAI       120
     VVAAYVSSEG NVLAAVVLAL TIGLAIGAVN ALIVTRLHVN GVIATLGMST ILGGIVLQRT       180
     GGLAPASDIP QSLTNFGTGL VAGVPIIFIT LLVIAGITYF VLNHTSLGRQ IYAVGSNMEA       240
     AKLVGLRTDG LRAVTFAAGG LLCGLGGLLY VSRAGGASPN VGMTFTLPAF AAAFLSAASV       300
     RPGRFNVWGT IIAVYFLAVL NNGLSLAGVD PYVNDYVNGG ALIAGVALAT VLYRRRTT         358
//

If you have problems or comments...

PBIL Back to PBIL home page