(data stored in ACNUC1104 zone)

EMBL: CP000509.PE597

CP000509.PE597       Location/Qualifiers
FT   CDS             650063..651214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0613"
FT                   /product="protein of unknown function DUF1100, hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF1100, hydrolase
FT                   family protein; KEGG: ppu:PP_3195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80147"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB2"
FT                   /protein_id="ABL80147.1"
FT                   /translation="MPRIRGTCRRPTAAQSGRCCLPTYGEEMTTETPQVPTAEEEMLNW
FT                   GRLLMDGLPFADLLAAQRRDAETSWFDFWMAKADAYEAMGETALKDGNDLTAGYWFWVG
FT                   SMAAQYAQFLWFDERRPKGQLRKAGLYHRAAPLLDPPAERVDLPIDDTVIIGYLRRPKG
FT                   ADGPVPCAVLLGGLESTKEESYMFENLLLERGVATFTFDGPGQGEMFEDVALAGDYHRY
FT                   TSRVVDYLETLGVTIDEDRIGVLGRSLGGHYALRAASMDDRFRACVTWGGFVQMDDWDF
FT                   EYPMTKLSWQYVTKSPDLPTAQERVKEAIDVRPVLAGLKVPTYVMHGAKDETPLTELDL
FT                   LQEYAVNADITIDLEPEGDHCCHNLGPAPRLRMADWLANQLRP"
     MPRIRGTCRR PTAAQSGRCC LPTYGEEMTT ETPQVPTAEE EMLNWGRLLM DGLPFADLLA        60
     AQRRDAETSW FDFWMAKADA YEAMGETALK DGNDLTAGYW FWVGSMAAQY AQFLWFDERR       120
     PKGQLRKAGL YHRAAPLLDP PAERVDLPID DTVIIGYLRR PKGADGPVPC AVLLGGLEST       180
     KEESYMFENL LLERGVATFT FDGPGQGEMF EDVALAGDYH RYTSRVVDYL ETLGVTIDED       240
     RIGVLGRSLG GHYALRAASM DDRFRACVTW GGFVQMDDWD FEYPMTKLSW QYVTKSPDLP       300
     TAQERVKEAI DVRPVLAGLK VPTYVMHGAK DETPLTELDL LQEYAVNADI TIDLEPEGDH       360
     CCHNLGPAPR LRMADWLANQ LRP                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page