(data stored in ACNUC1104 zone)

EMBL: CP000509.PE598

CP000509.PE598       Location/Qualifiers
FT   CDS             651308..651658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0614"
FT                   /product="protein of unknown function DUF861, cupin_3"
FT                   /note="PFAM: protein of unknown function DUF861, cupin_3;
FT                   Cupin 2, conserved barrel domain protein; KEGG: sma:SAV6269
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80148"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB3"
FT                   /protein_id="ABL80148.1"
FT                   /translation="MDEIKAVESGTVELETWQPDGVTIHEGDPKGRGFTLFENYESGAR
FT                   ATGVFECEPSKTTYTLEYNEIIYVLEGEVTIELENGSRVDLRAGMQAFLPAGHISTWTF
FT                   HTKFREVWVLAD"
     MDEIKAVESG TVELETWQPD GVTIHEGDPK GRGFTLFENY ESGARATGVF ECEPSKTTYT        60
     LEYNEIIYVL EGEVTIELEN GSRVDLRAGM QAFLPAGHIS TWTFHTKFRE VWVLAD           116
//

If you have problems or comments...

PBIL Back to PBIL home page