(data stored in ACNUC1104 zone)

EMBL: CP000509.PE599

CP000509.PE599       Location/Qualifiers
FT   CDS             654191..654460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80149"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB4"
FT                   /protein_id="ABL80149.1"
FT                   /translation="MTPGIVRGTLRHWLEVYGTGKKTAADGTLTSSPLQSTTTTTTSFG
FT                   TRERDAGAEGRPARGVHDVVAHVASAHRGRSRRHAGRARCRPGS"
     MTPGIVRGTL RHWLEVYGTG KKTAADGTLT SSPLQSTTTT TTSFGTRERD AGAEGRPARG        60
     VHDVVAHVAS AHRGRSRRHA GRARCRPGS                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page