(data stored in ACNUC1104 zone)

EMBL: CP000509.PE6

CP000509.PE6         Location/Qualifiers
FT   CDS             6391..8526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: pac:PPA0009 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79556"
FT                   /db_xref="GOA:A1SCM1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM1"
FT                   /protein_id="ABL79556.1"
FT                   /translation="MSDETPIENPAEGGSGTAAAEATDRRPNGVDYDASAIQVLEGLEA
FT                   VRKRPGMYIGSTGERGLHHLIWEIVDNAVDEALAGYCDRIVLTLLADGGIRVEDNGRGI
FT                   PTGTAPGQELPALTLALTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSTRLVAEVKNR
FT                   GHLWRQSFSAGVPDGELEQVRPVEPDEGTGTTITYWASPDIFETTTHSLETITSRIREY
FT                   AFLNKGLEIVVRDERPAAAEIVDAVEDDTVDPDHRGGIDDAGHDAIKRGEGGALEQIFK
FT                   YDRGLIDYVEHLNRRKTAANPTVIAFEAETPESVENHMSLEVAMQWNTSFSESVHTFAN
FT                   TINTHEGGTHEEGFRAALTSLVNNWGFEWGLMKKPEDRVSGDDIREGLTAIISIKLGEP
FT                   QFEGQTKTKLGNTEAKGFVQRLVNDQLGAWLEQNPAEGRDIVRKAQAAASARIAARKAR
FT                   DLARSRKGLLGGGGLPGKLSDCQSTNPAECEVFIVEGDSAGGSARQGRDPRIQAILPIR
FT                   GKILNVEKARIDKVLSNQEVQSIISALGTGIQDEFDIEKLRYHKVVLMADADVDGHHIN
FT                   TLLLTLLFRFMKPLIEGGYVYMAQPPLYRLRWNKPHEHEFVYSDAERDALLRAGQEAGK
FT                   KLPKENPVQRYKGLGEMNAKELWETTMDPEQRLMLQVTLDDAAHADEIFSILMGEDVEQ
FT                   RRSFIQRNAKDVRFLDI"
     MSDETPIENP AEGGSGTAAA EATDRRPNGV DYDASAIQVL EGLEAVRKRP GMYIGSTGER        60
     GLHHLIWEIV DNAVDEALAG YCDRIVLTLL ADGGIRVEDN GRGIPTGTAP GQELPALTLA       120
     LTVLHAGGKF GGGGYKVSGG LHGVGVSVVN ALSTRLVAEV KNRGHLWRQS FSAGVPDGEL       180
     EQVRPVEPDE GTGTTITYWA SPDIFETTTH SLETITSRIR EYAFLNKGLE IVVRDERPAA       240
     AEIVDAVEDD TVDPDHRGGI DDAGHDAIKR GEGGALEQIF KYDRGLIDYV EHLNRRKTAA       300
     NPTVIAFEAE TPESVENHMS LEVAMQWNTS FSESVHTFAN TINTHEGGTH EEGFRAALTS       360
     LVNNWGFEWG LMKKPEDRVS GDDIREGLTA IISIKLGEPQ FEGQTKTKLG NTEAKGFVQR       420
     LVNDQLGAWL EQNPAEGRDI VRKAQAAASA RIAARKARDL ARSRKGLLGG GGLPGKLSDC       480
     QSTNPAECEV FIVEGDSAGG SARQGRDPRI QAILPIRGKI LNVEKARIDK VLSNQEVQSI       540
     ISALGTGIQD EFDIEKLRYH KVVLMADADV DGHHINTLLL TLLFRFMKPL IEGGYVYMAQ       600
     PPLYRLRWNK PHEHEFVYSD AERDALLRAG QEAGKKLPKE NPVQRYKGLG EMNAKELWET       660
     TMDPEQRLML QVTLDDAAHA DEIFSILMGE DVEQRRSFIQ RNAKDVRFLD I                711
//

If you have problems or comments...

PBIL Back to PBIL home page