(data stored in ACNUC1104 zone)

EMBL: CP000509.PE601

CP000509.PE601       Location/Qualifiers
FT   CDS             complement(657099..658139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0619"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: nfa:nfa30730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80151"
FT                   /db_xref="GOA:A1SEB6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB6"
FT                   /protein_id="ABL80151.1"
FT                   /translation="MTRAKTRRVSAIAEDPVTPAGVTRVTVGDALRVSHQLALTAATAI
FT                   APMVWGTTYSVTTELLPANRPLFAALMRSLPIGLLAILLTRVLPRRDWWWKAAVLGMLN
FT                   IGSFFPLLFIAAERLPGGVAATLGAAQPLFVTGLAVVMLGERLSLLRLAWGVVGLVGVG
FT                   LVVLGPDVGFDPFGILAGLVGACAMGVGMTLTKRWGRPAGISPISFAAWQLAVGGLALL
FT                   PATLLVEGLPSHVGISSAAGYLWLGAIGGLLAYALWFRGIGRLPVTSAALLGLVSPLVA
FT                   ALMGMLLGERLNSIQVFGFVLALIAVVGGSARVRPIQTDRIQQKATLNLVQPDKVPAEN
FT                   PARFRP"
     MTRAKTRRVS AIAEDPVTPA GVTRVTVGDA LRVSHQLALT AATAIAPMVW GTTYSVTTEL        60
     LPANRPLFAA LMRSLPIGLL AILLTRVLPR RDWWWKAAVL GMLNIGSFFP LLFIAAERLP       120
     GGVAATLGAA QPLFVTGLAV VMLGERLSLL RLAWGVVGLV GVGLVVLGPD VGFDPFGILA       180
     GLVGACAMGV GMTLTKRWGR PAGISPISFA AWQLAVGGLA LLPATLLVEG LPSHVGISSA       240
     AGYLWLGAIG GLLAYALWFR GIGRLPVTSA ALLGLVSPLV AALMGMLLGE RLNSIQVFGF       300
     VLALIAVVGG SARVRPIQTD RIQQKATLNL VQPDKVPAEN PARFRP                      346
//

If you have problems or comments...

PBIL Back to PBIL home page