(data stored in ACNUC1104 zone)

EMBL: CP000509.PE602

CP000509.PE602       Location/Qualifiers
FT   CDS             658209..659132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0620"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: sma:SAV4790 LysR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80152"
FT                   /db_xref="GOA:A1SEB7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB7"
FT                   /protein_id="ABL80152.1"
FT                   /translation="MRYVLAVADARNFTRAAEQCFVVQSALSQRIANLERELGVALFAR
FT                   TSRRVELTAAGQAFIPPARQCLEAADRAAAEAAAAVGQVRGRLTIGVIPNVAAVDLPDV
FT                   LRRVREKYLAVRIELRVGASDWLAEQVVAGNLDVAFLGLPENQKPVGVSFRALASDRHV
FT                   AVLPVDHHLAGRAEVGLADLSDEAFADFPYGSPGRAQGDYAFASAEIRRDVAYEVVSAD
FT                   LMLDLVRHGLAVALLPSMSVNPMPELAIVSVTDGPGRVEYLAWSDFNPSPATRAFLDIL
FT                   ADEASPGTGHDVHRSALPAIRGSDPT"
     MRYVLAVADA RNFTRAAEQC FVVQSALSQR IANLERELGV ALFARTSRRV ELTAAGQAFI        60
     PPARQCLEAA DRAAAEAAAA VGQVRGRLTI GVIPNVAAVD LPDVLRRVRE KYLAVRIELR       120
     VGASDWLAEQ VVAGNLDVAF LGLPENQKPV GVSFRALASD RHVAVLPVDH HLAGRAEVGL       180
     ADLSDEAFAD FPYGSPGRAQ GDYAFASAEI RRDVAYEVVS ADLMLDLVRH GLAVALLPSM       240
     SVNPMPELAI VSVTDGPGRV EYLAWSDFNP SPATRAFLDI LADEASPGTG HDVHRSALPA       300
     IRGSDPT                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page