(data stored in SCRATCH zone)

EMBL: CP000509.PE604

CP000509.PE604       Location/Qualifiers
FT   CDS             660057..661448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0622"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   fal:FRAAL6023 hypothetical protein; putative signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80154"
FT                   /db_xref="GOA:A1SEB9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB9"
FT                   /protein_id="ABL80154.1"
FT                   /translation="MRDQQAHAAATPSFWHEDADLDWAPKGPLDGDLDVDVAIVGGGYT
FT                   GLWTAYYLAKADPSLRIAILEKYFVGFGASGRNGGWCSAIFPTTLRKVAADSSRSAAVR
FT                   MQEAMFETVKEVGEVVVAEGIECDFQPGGYVSVARNEAQWVRSQREVDGWRAWGFGEEH
FT                   FRMLTPDEAAERVATSHTLGGTFTPHCAVVQPAKLVRGLGDVVRALGVRIFEATEVREI
FT                   HSGGLSTARGTVRADVVVRATEGYTAQLKGARREVVPMYSLMVATAPLPEEIWQEIGLR
FT                   ERETFSDKRHLRIYGQRTRDGRIAFGGRGAPYHFGSRVKPEFDDDRRVHEMLRNILVDL
FT                   LPTIRGVEFTHAWGGNLGIPRDWYPSVGYDRSSGIGHAGGYVGDGVATANLAGRTLAAE
FT                   ILDLENDVRSLPWVGRTTPRWEPEPLRWIGVNAGTAAFNIADRTEARFGKPSRLASGLW
FT                   KVLGH"
     MRDQQAHAAA TPSFWHEDAD LDWAPKGPLD GDLDVDVAIV GGGYTGLWTA YYLAKADPSL        60
     RIAILEKYFV GFGASGRNGG WCSAIFPTTL RKVAADSSRS AAVRMQEAMF ETVKEVGEVV       120
     VAEGIECDFQ PGGYVSVARN EAQWVRSQRE VDGWRAWGFG EEHFRMLTPD EAAERVATSH       180
     TLGGTFTPHC AVVQPAKLVR GLGDVVRALG VRIFEATEVR EIHSGGLSTA RGTVRADVVV       240
     RATEGYTAQL KGARREVVPM YSLMVATAPL PEEIWQEIGL RERETFSDKR HLRIYGQRTR       300
     DGRIAFGGRG APYHFGSRVK PEFDDDRRVH EMLRNILVDL LPTIRGVEFT HAWGGNLGIP       360
     RDWYPSVGYD RSSGIGHAGG YVGDGVATAN LAGRTLAAEI LDLENDVRSL PWVGRTTPRW       420
     EPEPLRWIGV NAGTAAFNIA DRTEARFGKP SRLASGLWKV LGH                         463
//

If you have problems or comments...

PBIL Back to PBIL home page