(data stored in ACNUC1104 zone)

EMBL: CP000509.PE61

CP000509.PE61        Location/Qualifiers
FT   CDS             70016..70936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0062"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: rha:RHA1_ro02811
FT                   fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79611"
FT                   /db_xref="GOA:A1SCS6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS6"
FT                   /protein_id="ABL79611.1"
FT                   /translation="MNSPGVLVIGEALIDIVEAPSGAVAEAPGGSPLNVAVTLGRLGVP
FT                   VTLATALGDDERADRIQAHLADSGVALAAGARTLDRTASARARMQSDGSALYDLDVTWD
FT                   PATPDPGGATAIHAGSIALFQEPGASRVGDVLRRAPAGAMISLDPNIRPSLLPGRRRVV
FT                   AQFEQLAALAHLVKLSDEDAAWLYPDLTWRQVAQHLLRLGPTLVVVTRGGQGSHLAAAG
FT                   ITVDRPAITSVIADTIGAGDSFMGALIRQALALGVIDRLVSRSALGSHDLVTLGDAAGL
FT                   VAAVTVSRVGADPPWDWEIDAALTE"
     MNSPGVLVIG EALIDIVEAP SGAVAEAPGG SPLNVAVTLG RLGVPVTLAT ALGDDERADR        60
     IQAHLADSGV ALAAGARTLD RTASARARMQ SDGSALYDLD VTWDPATPDP GGATAIHAGS       120
     IALFQEPGAS RVGDVLRRAP AGAMISLDPN IRPSLLPGRR RVVAQFEQLA ALAHLVKLSD       180
     EDAAWLYPDL TWRQVAQHLL RLGPTLVVVT RGGQGSHLAA AGITVDRPAI TSVIADTIGA       240
     GDSFMGALIR QALALGVIDR LVSRSALGSH DLVTLGDAAG LVAAVTVSRV GADPPWDWEI       300
     DAALTE                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page