(data stored in ACNUC1104 zone)

EMBL: CP000509.PE62

CP000509.PE62        Location/Qualifiers
FT   CDS             71344..71673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0063"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mbo:Mb2839c probable transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79612"
FT                   /db_xref="GOA:A1SCS7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS7"
FT                   /protein_id="ABL79612.1"
FT                   /translation="MARPSKYPRELRECAVRAVAESVAQGEYPTEFEAIRTIAAQLGIG
FT                   SSETLRKWVRQAEVDGGTRPGKTTEELAEIRELKKKVAELERANQILKSASAFFAAELD
FT                   RQPRY"
     MARPSKYPRE LRECAVRAVA ESVAQGEYPT EFEAIRTIAA QLGIGSSETL RKWVRQAEVD        60
     GGTRPGKTTE ELAEIRELKK KVAELERANQ ILKSASAFFA AELDRQPRY                   109
//

If you have problems or comments...

PBIL Back to PBIL home page