(data stored in ACNUC1104 zone)

EMBL: CP000509.PE64

CP000509.PE64        Location/Qualifiers
FT   CDS             complement(76344..77522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0068"
FT                   /product="Inulin fructotransferase (DFA-I-forming)"
FT                   /EC_number="4.2.2.17"
FT                   /note="KEGG: ret:RHE_PE00355 putative inulin
FT                   fructotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79614"
FT                   /db_xref="GOA:A1SCS9"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR040526"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS9"
FT                   /protein_id="ABL79614.1"
FT                   /translation="MATTVYDVTTWTGATVSPYTDIGLVINQIIADIKSQQNSQTTRPG
FT                   AVIYIPPGHYTLQTTANIDIGFLTIKGSGHGFMSEAIRDDVNHSAWVETLPGSSHVQIA
FT                   NNNQVGFLVNRATDPGTNGRLNSIVFQDFCIDGVSSTKPYIPGNGKIGIKSQYDTDSLR
FT                   IEGMGFVYLNTALTIRNADAFNITNNFIAECGSSIQLTDSSIVGKITNNYLISAWAGNS
FT                   IFIENNEDCVISGNSLLWGARIQMKNVHRAVITGNKFVSNFSGMIVHETPCHEQLISGN
FT                   HFRRKYGDGGPARNDDLFGMVHLNGNDNSVTANHFAFEVPAANIVPSGATPTVVLVKGG
FT                   ARNFLATNKLASNVAVRHVLDASSTATKVLWSGTAAQLQDLSGGNMSFVATP"
     MATTVYDVTT WTGATVSPYT DIGLVINQII ADIKSQQNSQ TTRPGAVIYI PPGHYTLQTT        60
     ANIDIGFLTI KGSGHGFMSE AIRDDVNHSA WVETLPGSSH VQIANNNQVG FLVNRATDPG       120
     TNGRLNSIVF QDFCIDGVSS TKPYIPGNGK IGIKSQYDTD SLRIEGMGFV YLNTALTIRN       180
     ADAFNITNNF IAECGSSIQL TDSSIVGKIT NNYLISAWAG NSIFIENNED CVISGNSLLW       240
     GARIQMKNVH RAVITGNKFV SNFSGMIVHE TPCHEQLISG NHFRRKYGDG GPARNDDLFG       300
     MVHLNGNDNS VTANHFAFEV PAANIVPSGA TPTVVLVKGG ARNFLATNKL ASNVAVRHVL       360
     DASSTATKVL WSGTAAQLQD LSGGNMSFVA TP                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page