(data stored in ACNUC1104 zone)

EMBL: CP000509.PE67

CP000509.PE67        Location/Qualifiers
FT   CDS             80377..80844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0071"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   rha:RHA1_ro03337 probable leucine-responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79617"
FT                   /db_xref="GOA:A1SCT2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT2"
FT                   /protein_id="ABL79617.1"
FT                   /translation="MDSLDRAIIDHLRRNAHLTNTELAELVGLTPSPCLRRVRRLENEG
FT                   IILGYHAHIAPVALHRGFEVHVDLELADQTKQTIRVFEAALIAYDEVVEARRMFGAPDY
FT                   QALVAVTDLPAYEHFLTEHLTALPGLGRLQSRFPMKTIKTDTPSTPPTTRH"
     MDSLDRAIID HLRRNAHLTN TELAELVGLT PSPCLRRVRR LENEGIILGY HAHIAPVALH        60
     RGFEVHVDLE LADQTKQTIR VFEAALIAYD EVVEARRMFG APDYQALVAV TDLPAYEHFL       120
     TEHLTALPGL GRLQSRFPMK TIKTDTPSTP PTTRH                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page