(data stored in SCRATCH zone)

EMBL: CP000509.PE69

CP000509.PE69        Location/Qualifiers
FT   CDS             82532..83164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0073"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   nfa:nfa13110 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79619"
FT                   /db_xref="GOA:A1SCT4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT4"
FT                   /protein_id="ABL79619.1"
FT                   /translation="MNGRTPAQSFVSGPLSRAILRLRTQRGLSLSALADQSGVAKGTLS
FT                   NLERGVGNPTLETIFALSRGLGVPIGELVSSEEEAASTFVGRDDARHIRGVAVELMLYD
FT                   RFASTGSATEIYDFRCLPGDRQVSRGHPGVEHIVVKQGRLLTGPTSSPIEVGPGDYVSF
FT                   PSWGDHAYEALDEVVEGFLVIHYPNPAAPSVAIKVESLDSHADRRKP"
     MNGRTPAQSF VSGPLSRAIL RLRTQRGLSL SALADQSGVA KGTLSNLERG VGNPTLETIF        60
     ALSRGLGVPI GELVSSEEEA ASTFVGRDDA RHIRGVAVEL MLYDRFASTG SATEIYDFRC       120
     LPGDRQVSRG HPGVEHIVVK QGRLLTGPTS SPIEVGPGDY VSFPSWGDHA YEALDEVVEG       180
     FLVIHYPNPA APSVAIKVES LDSHADRRKP                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page